SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015534 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015534
Domain Number 1 Region: 52-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-27
Family Nuclear receptor 0.00000882
Further Details:      
 
Domain Number 2 Region: 147-241
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-16
Family Nuclear receptor ligand-binding domain 0.00000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015534   Gene: ENSPTRG00000009112   Transcript: ENSPTRT00000016787
Sequence length 361
Comment pep:novel chromosome:CHIMP2.1.4:17:17288391:17305609:-1 gene:ENSPTRG00000009112 transcript:ENSPTRT00000016787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
EEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLGEAGSLQGP
VLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVCEDLAGNAAS
P
Download sequence
Identical sequences ENSPTRP00000015534 ENSPTRP00000015534 9598.ENSPTRP00000015534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]