SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015608 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015608
Domain Number 1 Region: 343-413
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.71e-22
Family Intermediate filament protein, coiled coil region 0.00093
Further Details:      
 
Domain Number 2 Region: 102-135
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000183
Family Intermediate filament protein, coiled coil region 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000015608
Domain Number - Region: 71-106,147-153,411-431
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0549
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015608   Gene: ENSPTRG00000009162   Transcript: ENSPTRT00000016864
Sequence length 449
Comment pep:known chromosome:CHIMP2.1.4:17:15975568:15980886:1 gene:ENSPTRG00000009162 transcript:ENSPTRT00000016864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFYSTSSCPLGCTMAPGARNVSVSPIDVGCQPGAEANAASMCLLANVAHANRVRVGST
PLGRPSLCLPPTCHTACPLPGTCHIPGNIGICGAYGKNTLNGHEKETMQFLNDRLANYLE
KVRQLEQENAELETTLLERSKCHESTVCPDYQSYFRTIEELQQKILCSKAENARLIVQID
NAKLAADDFRIKLESERSLRQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEHLSLKS
NHEQEVKILRSQLGEKFRIELDIEPTIDLNRVLGEMRAQYEAMVETNRQDVEQWFQAQSE
GISLQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCEAEDRYGTELA
QMQSLISNLEEQLSEIRADLERQNQEYQVLLDVKARLENEIATYRNLLESEDCKLPCNPC
STPASCTSCPSCGPVTGGSPSGYGASTGR
Download sequence
Identical sequences H2QCY7
9598.ENSPTRP00000015608 ENSPTRP00000015608 ENSPTRP00000015608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]