SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015610 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015610
Domain Number 1 Region: 334-405
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-22
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 2 Region: 94-129
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000575
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 12-71,404-447
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000015610
Domain Number - Region: 207-320
Classification Level Classification E-value
Superfamily Prefoldin 0.000131
Family Prefoldin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015610   Gene: ENSPTRG00000009164   Transcript: ENSPTRT00000016866
Sequence length 448
Comment pep:known chromosome:CHIMP2.1.4:17:15932501:15940626:1 gene:ENSPTRG00000009164 transcript:ENSPTRT00000016866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCMPTTFRPAS
CLSKTYLSSSCRAASGISGSMGPGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQE
NAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADD
FRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGS
LRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANRRDVEEWFNMQMEELNQQVAT
SSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITN
VEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLESEDCKLPCNPCSTPSCTTC
VPSPCVPRTICVPRTVGVPCSPCPQGRY
Download sequence
Identical sequences A5A6M9 H2QCY9
ENSPTRP00000015610 NP_001092022.1.37143 ENSPTRP00000015610 9598.ENSPTRP00000015610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]