SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015689 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015689
Domain Number 1 Region: 79-186
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000481
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 496-559,610-641
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000478
Family Second domain of FERM 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000015689
Domain Number - Region: 388-483
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000162
Family Ras-binding domain, RBD 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015689   Gene: ENSPTRG00000009214   Transcript: ENSPTRT00000016948
Sequence length 781
Comment pep:known chromosome:CHIMP2.1.4:17:14708104:14717086:1 gene:ENSPTRG00000009214 transcript:ENSPTRT00000016948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDKDQDKETFGPLEVTLTQPVRSGPVSN
RLQSWEETWSLIPEKGLPEDDPDIVVKGWLYREPRGGGARPWLPPRRAWFVLTRDSLDQF
SSSGKGARRLGSLVLTSLCSVTGPERRRKETGLWSVTVSGRKHSVRLCSPRQAEAERWGV
ALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYLRNPILRHTSGALYAPLLPLPYG
VSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPALRDELFLQLAKQT
SGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERTEQALPDSELAEY
ARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACAVAIDSHTTAGEVARE
LVGRLGLARSRNAFALYEQRGAQERALAGGTLVADVLTRFENLAAEEGGLEDSPDSGWRL
CLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRGRPPPPDDTLRALAALRLQSLHRDFSP
RVPLPRLDRLLPPPAPPREDPPRPTPRPPPSAALLAGALWSPGLAKRRAERARRGGAGRT
AGSIAREGGGGAGTAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGFGAARYDVLELSTE
PGGGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQ
SPQVEEIMQLVNAYLANPSPERPCSSSSPPCQDLPDTSPPSQRPGLDEPQGQSGCLGQLQ
D
Download sequence
Identical sequences 9598.ENSPTRP00000015689 ENSPTRP00000015689 ENSPTRP00000015689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]