SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016060 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016060
Domain Number 1 Region: 259-509
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-33
Family Protein kinases, catalytic subunit 0.00064
Further Details:      
 
Domain Number 2 Region: 25-146
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-22
Family Ankyrin repeat 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016060   Gene: ENSPTRG00000009457   Transcript: ENSPTRT00000017345
Sequence length 1491
Comment pep:known chromosome:CHIMP2.1.4:17:57257648:57404157:-1 gene:ENSPTRG00000009457 transcript:ENSPTRT00000017345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRAVRLPVPCPVQLGTLRNDSLEAQLHEYVKQGNYVKVKKILKKGIYVDAVNSLGQTAL
FVAALLGLRKFVDVLVDYGSDPNHRCFDGSTPVHAAAFSGNQWILSKLLDAGGDLRLHDE
RGQNPKTWALTAGKERSTQIVEFMQSCASHMQAIIQGFSYDLLKKIDSPQRLVYSPSWCG
GLVQGNPNGSPNRLLKAGVISAQNIYSFGFGKFYLTGATQMAYLGSLPVIGEKEVIQADD
EPTFSFFSGPYMVMTNLVWNGSRVTVKELNLPTHPHCSKLRLADLLIAEQEHSSKLRHPY
LLQLMAVCLSQDLEKTRLVYERITIGTLFSVLHERRSQFPVLHMEVIVHLLLQISDALRY
LHFQGFIHRSLSSYAVHIISPGEARLTNLEYMLESEDRGVQRDLTRVPLPTQLYNWAAPE
VILQKTATVKSDIYSFCMIMQEILTDDIPWNGLDGSVVKKAVVLGNYLEADVRLPKPYYD
IVKSGIHVKQKDRTMNLQDIRYILKNDLKDFTGAQRTQPTESPRVQRYRLHPDVNVYLGL
TSEHPRETPDMEIIELKEMGSQPHSPRVHSLFTEGTLDPQAPDPCLMARETANQDAPCPA
PFMAEEASSPSTGQPSLCSFEINEIYSGCLILEDDIEEPPGAASSLEADGPNQVDELKSM
EEELDKMEREACCFGSEDESSSKAETEYSFDDWDWQNGSLSSLSLPESTREAKSNLNNMS
TTEEYLISKCVLDLKIMQTIMHENDDRLRNIEQILDEVEMKQKEQEERMSLWATSREFTN
AYKLPLAVGPPSLNYIPPVLQLSGGQQQDTSGNYPTLPRFPRMLPTLCDPGKQNTDEQFQ
CTQGAKDSLETSRIQNTSSQGRPRESTAQAKATLFNSALFTLSSHRQGPSASPNCHWDST
RMSVEPVSSEIYNAESRNKDDGKVHLKWKMEVKEMAKKAATGQLTVPPWHPQSSLTLESE
AENEPDALLPPPIRSPENTDWQRVIEYHRENDEPRGNGKFDKTGNYDCDSDQHGRQPRPG
SFTSIRHPSPRQKEQPEHSEAFQASSDTLVAVEKSYSHQSMQSTCSPESSEDITDEFLTP
DDEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKNAEILPRS
QFQPVRSTEDEQEETSKESPKELKEKDISLTDIQDLSSISYEPDSSFKEASCKTPKINHA
PTSVSTPLSPGSVSSAASQYKDCLESITFQVKTEFASCWNSQEFIQTLSDDFISVRERAK
KLDSLLTSSETPPSRLTGLKRLSSFIGAGSPSLVKACDSSPPHATQRRSLPKVEAFSQHH
IDELPPPSQELLDEIELLKQQQGSSMVLHENTASDAGGTANDQRHLEEQETDSKKEDSSM
LLSKETEDLGEDTERAHSTLDEDLERWLQPPEESVELQDLPKGSERETNIKDQKVGEEKR
KREDSITPERRKSEGVLGTSEEDELKSCFWKRLGWSESSRIIVLDQSDLSD
Download sequence
Identical sequences ENSPTRP00000016060 ENSPTRP00000016060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]