SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016166 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016166
Domain Number 1 Region: 67-239,285-354
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.38e-43
Family Protein kinases, catalytic subunit 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016166   Gene: ENSPTRG00000009520   Transcript: ENSPTRT00000017457
Sequence length 374
Comment pep:known chromosome:CHIMP2.1.4:17:62453896:62480094:-1 gene:ENSPTRG00000009520 transcript:ENSPTRT00000017457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMS
SFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELH
VSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVL
KALDYIHHMGYVHRNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVP
CLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVE
QCLQRNPDARASASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSHSQDHSGIFGL
VTNLEELEVDDWEF
Download sequence
Identical sequences 9598.ENSPTRP00000016166 ENSPTRP00000016166 ENSPTRP00000016166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]