SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016256 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000016256
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily TIMP-like 0.0785
Family Netrin-like domain (NTR/C345C module) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016256   Gene: ENSPTRG00000009569   Transcript: ENSPTRT00000017548
Sequence length 75
Comment pep:novel chromosome:CHIMP2.1.4:17:66653762:66656285:-1 gene:ENSPTRG00000009569 transcript:ENSPTRT00000017548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLYLTPDGFFFRVHMLALDSSSCNKPCPEFKPGIETDLNDAAYVLYTTVCNVGATARA
VGRPAFFWERWGTMT
Download sequence
Identical sequences K7APH7
XP_008962998.1.60992 XP_008962999.1.60992 XP_009431263.1.37143 XP_016802251.1.37143 ENSPTRP00000016256 9598.ENSPTRP00000016256 ENSPTRP00000016256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]