SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016424 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016424
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-104
Family Protein kinases, catalytic subunit 0.00000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016424   Gene: ENSPTRG00000009667   Transcript: ENSPTRT00000017727
Sequence length 305
Comment pep:known chromosome:CHIMP2.1.4:17:74956206:74961823:1 gene:ENSPTRG00000009667 transcript:ENSPTRT00000017727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFHH
Download sequence
Identical sequences H2QDX1
ENSPTRP00000016424 XP_008964061.1.60992 XP_016786402.1.37143 9598.ENSPTRP00000016424 ENSPTRP00000016424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]