SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016665 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016665
Domain Number 1 Region: 5-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-87
Family Protein kinases, catalytic subunit 0.0000000000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016665   Gene: ENSPTRG00000009796   Transcript: ENSPTRT00000017987
Sequence length 415
Comment pep:known chromosome:CHIMP2.1.4:17:81728693:81761039:-1 gene:ENSPTRG00000009796 transcript:ENSPTRT00000017987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Download sequence
Identical sequences A0A096NTN3 A0A1S2ZU06 A0A1U7SVB7 A0A2I2YHH5 A0A2I3HB71 A0A2J8XZG5 A0A2K5C9G1 A0A2K5JKB7 A0A2K5LZB4 A0A2K5Q8I2 A0A2K5WW54 A0A2K6CDJ8 A0A2K6MBB2 F6QGF4 H2QE47 H9EP07 P35508 P48730
ENSGGOP00000000073 CSNK1D NP_001884.2.87134 NP_001884.2.92137 XP_001167815.1.37143 XP_002748894.1.60252 XP_003809000.1.60992 XP_004013101.2.66739 XP_004040801.1.27298 XP_004275647.1.21590 XP_005221107.1.76553 XP_005585378.1.63531 XP_006061857.1.26621 XP_007462356.1.90284 XP_007524518.1.11023 XP_008011541.1.81039 XP_008048103.1.4292 XP_010854667.1.44457 XP_011718575.1.29376 XP_011782169.1.43180 XP_011921403.1.92194 XP_011964734.1.54773 XP_012308087.1.9421 XP_014976131.1.72884 XP_017380238.1.71028 XP_017734672.1.44346 XP_017920900.1.57651 XP_019836465.1.53367 XP_020762977.1.74333 ENSPTRP00000016665 ENSNLEP00000017163 ENSP00000324464 ENSNLEP00000017163 ENSGGOP00000000073 gi|20149530|ref|NP_001884.2| ENSPTRP00000016665 ENSPANP00000016404 ENSCJAP00000033288 ENSBTAP00000026621 9606.ENSP00000324464 9913.ENSBTAP00000026621 ENSBTAP00000026621 ENSP00000324464 ENSCJAP00000033248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]