SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016691 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016691
Domain Number 1 Region: 2-307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.9e-44
Family APH phosphotransferases 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016691   Gene: ENSPTRG00000009809   Transcript: ENSPTRT00000018016
Sequence length 309
Comment pep:known chromosome:CHIMP2.1.4:17:82221780:82233022:1 gene:ENSPTRG00000009809 transcript:ENSPTRT00000018016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLT
AILKTNTVKVPKPIKVLDAPGGGSVLVMEHVDMRHLSSHAAKLGAQLADLHLDNKKLGEM
RLKEAGTVGRGGGQEERPFVDQFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMDMV
EKESGDREALQLWSALQLKIPDLFHDLEIIPALLHGDLWGGNVAEDSSGPVIFDPASFYG
HSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRLQLYQLFHYLNHWNHFGSGYRGSS
LNIMRNLVK
Download sequence
Identical sequences H2QE58
ENSPTRP00000016691 ENSPTRP00000016691 XP_016786477.1.37143 XP_523753.2.37143 9598.ENSPTRP00000016691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]