SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016692 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016692
Domain Number 1 Region: 21-307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.66e-43
Family APH phosphotransferases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016692   Gene: ENSPTRG00000009810   Transcript: ENSPTRT00000018017
Sequence length 309
Comment pep:known chromosome:CHIMP2.1.4:17:82241681:82257182:1 gene:ENSPTRG00000009810 transcript:ENSPTRT00000018017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFVKVNRRTQARQMFEGEVASLE
ALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMRSLSSQASKLGEQMADLHLYNQKLREK
LKEEENTVGRRGEGAEPQYVNKFGFHTVTCCGFIPQVNEWQDDWPTFFARHRLQAQLDLI
EKDYADREARELWSRLQVKIPDLFCGLEIVPALLHGDLWSGNVAEDDVGPIIYDPASFYG
HSEFELAIALMFGGFPRSFFTAYHRKIPKAPGFDQRLLLYQLFNYLNHWNHFGREYRSPS
LGTMRRLLK
Download sequence
Identical sequences H2QE59
ENSPTRP00000016692 ENSPTRP00000016692 XP_003315831.1.37143 XP_003809018.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]