SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016940 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016940
Domain Number 1 Region: 32-161
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 231-291
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.36e-19
Family EB1 dimerisation domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016940   Gene: ENSPTRG00000009965   Transcript: ENSPTRT00000018289
Sequence length 315
Comment pep:known chromosome:CHIMP2.1.4:18:30754500:30918104:1 gene:ENSPTRG00000009965 transcript:ENSPTRT00000018289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQNRDQKCPVSQRNSSFPQPGRKPGCSSWGMAVNVYSTSITQETMSRHDIIAWVNDIVS
LNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDK
VIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLP
KKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVH
SLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDVLYASEEHEGHTEEPEA
EEQAHEQQPPQQEEY
Download sequence
Identical sequences H2QEF5
XP_003315905.1.37143 XP_014197788.1.60992 ENSPTRP00000016940 ENSPTRP00000016940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]