SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017080 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017080
Domain Number 1 Region: 1753-2031
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.84e-71
Family MHCK/EF2 kinase 0.00067
Further Details:      
 
Domain Number 2 Region: 10-105
Classification Level Classification E-value
Superfamily Immunoglobulin 5.25e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 1696-1770
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000308
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017080   Gene: ENSPTRG00000010052   Transcript: ENSPTRT00000018439
Sequence length 2065
Comment pep:known chromosome:CHIMP2.1.4:18:54578505:54710384:-1 gene:ENSPTRG00000010052 transcript:ENSPTRT00000018439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSEGPQRPPLCFLSTLLSQKVPEKSDAVLRCIISGQPKPEVTWYKNGQAIDGSGIISN
YEFFENQYIHVLHLSCCTKNDAAVYQISAKNSFGMICCSASVEVECSSENPQLSPNLEDD
RDRGWKHETGTHEEESANQIDEKEHPYKEEESISPGTPRSADSSPSKSNHSLSLQSLGNL
DISVSSSENPLGVKGTRHTGEAYDPSNTEEIANGLLFLNSSHIYEKQDGCCHKTVHSMAS
KFTDGDLNNDGPHDEGLRSSQQNPKVQKYISLSLPLSEATAHIYPGDSAVANKQPSPQLS
SEDSDSDYELCPEITLTYTEEFSDDDLEYLECSDVMTDYSNAVWQRNLLGTEHVFLLESD
DEEMEFGEHCLGGCEHFLSGMGCGSWVSGDAGPMVATAGFCGHHSQPQEVGVRSSRVSKH
GPSSPQTGMTLILGPHQDGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFA
SDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKTGSQKSARVRQP
GMKGNPKKPNAKLRESTTEGTLHLCSAKESAKPPLTQSDKRETSHTTAAATGRNSHADAR
QCAISTQAEQEAKTLQTSTDSVSKEGNTNCKGEGMQVNTLFETSQVPDWSDPPQVQIQET
VRETISCSQMPAFSEPAGEESPFTGTTTISFSNLGGVHKENASFAQHSEVKPCTCGPQQE
EKQDRDGNIPDNFREGLKYEQSISEANDENMSPGVFSRHLPKDARADFREPVAVSVASPE
PTDTALTLENVCDEPRDRVAVCAMECFEAGDQGTCFDTIDSLVGTPVDKYLPQEICSVDT
VELAEGQNKVSDLCSSNDKTLEVFFQTQVSETSVSTCKSSKDGNSVMSPLFTSTFTLNIS
HTASEGATGENLAKVENSTYPLASTVHAGQEQPSPSNSGGLDETQLLSSENNPLVQFKEG
GDKSPSPSAADTTATPASYSSIVSFPWEKPTTLTANNECFQATRETEDTSTVTIATEVHP
AKYLAVSIPEDKHAGGTEERFPRASHEKVSQFPSQVQLDHILSGATIKSTKELLCRAPSV
PGVPHHVLQLPEGEGFCSNSPLQVDNLSGDKSQTVDRADFRSYEENFQERGSETKQGLQQ
QSLSQQGSLSAPDFQQSLPTTSAAQEERNLVPTAHSPASSREGAGQRSGWGTRVSVVAET
AGEEDSQALSNVPSLSDILLEESKEYRPGNWEAGNKLKIITLEASASEIWPPRQLTNSES
KASDGGLIIPDKVWAVPDSLKADAVVPEFCPKILESSVDPIDEISVTEYTRAGKPEPSET
TPQGAREGGQSNDGNMGHEAEIQPAILQVPCLQGTILSENRISRSQEGSMKQEAEQIQPE
EAKTAIWQVLQPSEGGQRIPSGCSIGQIQESSDGSLGEAEQSKKDKAELISPTSPLSSCL
PIMTHASLGVDTHNSTGQIHDVPENDIVEPRKRQYVFPVSQKRGTIENERGKPLPSSPDL
TRFPCTSSPEGNVTDFLISHKMEEPKIEVLQIGETKPPSSSSSSAKSLAFISGERELEKA
PKLLQDPCQKGTLGCVKKSREREKSLEARAGKSPGALTAVMGSEEVKRKPEAPGSGHLAE
GVKKKILSRVAALRLKLEEKENIRKNSAFLKKMPKLETSLSHTEEKQDPKKPSCKREGRA
PVLLRKIQAEMFPEHSGNVKLSCQFAEIHEDSTICWTKDSKSIAQVQRSAGDNSTVSFAI
VQASPKDQGLYYCCIKNSYGKVTAEFNLTAEVLKQLSSRQDTKGCEEIEFSQLIFKEDFL
HDSYFGGRLRGQIATEELHFGEGVHRKAFRSTVMHGLTPVFKPGHACVLKVHNAIAYGTR
NNDELIQRNYKLAAQECYVQNTARYYAKIYAAEARPLEGFGEVPEIIPIFLIHRPENNIP
YATVEEELIGEFVKYSIRDGKEINFLRRESEAGQKCCTFQHWVYQKTSGCLLVTDMQGVG
MKLTDVGIATLAKGYKGFKGNCSMTFIDQFKALHQCNKYCKMLGLKSLQNNNQKQKQPSI
GKSKVQTNSITVKKTGPETPGEKKT
Download sequence
Identical sequences ENSPTRP00000017080 ENSPTRP00000017080 9598.ENSPTRP00000017080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]