SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017469 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017469
Domain Number 1 Region: 89-338
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-67
Family Protein kinases, catalytic subunit 0.000000154
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000017469
Domain Number - Region: 44-76
Classification Level Classification E-value
Superfamily SH2 domain 0.00728
Family SH2 domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017469   Gene: ENSPTRG00000010278   Transcript: ENSPTRT00000018875
Sequence length 365
Comment pep:novel chromosome:CHIMP2.1.4:19:3778026:3785353:-1 gene:ENSPTRG00000010278 transcript:ENSPTRT00000018875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGHFPAERREGRPRRGTCGRQQLLVSPRFLRAWHPPPVSARMPTVFFCLMDMVEHYSKD
KGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKV
AVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTR
GRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERK
GLDSSRLPVKWTAPEALKHGSKSDVWSFGVLLWEVFSYDGAPYPKMSLKEVSEAVEKGYR
MEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSP
RSQEP
Download sequence
Identical sequences 9598.ENSPTRP00000042453 ENSPTRP00000017469 ENSPTRP00000042453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]