SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017483 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017483
Domain Number 1 Region: 6-313
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-85
Family Protein kinases, catalytic subunit 0.00000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017483   Gene: ENSPTRG00000010286   Transcript: ENSPTRT00000018891
Sequence length 454
Comment pep:known chromosome:CHIMP2.1.4:19:3977007:3988455:-1 gene:ENSPTRG00000010286 transcript:ENSPTRT00000018891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
Download sequence
Identical sequences A0A2J8SBR2 G2HGB3 O43293
9598.ENSPTRP00000017483 9606.ENSP00000301264 ENSP00000301264 ENSPTRP00000017483 NP_001233503.1.37143 NP_001339.1.87134 NP_001339.1.92137 XP_005259565.1.92137 XP_016789511.1.37143 ENSP00000301264 ENSP00000442973 ENSPTRP00000017483 ENSP00000301264 ENSP00000442973 gi|4557511|ref|NP_001339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]