SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017657 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017657
Domain Number 1 Region: 102-307
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-53
Family DBL homology domain (DH-domain) 0.00000000584
Further Details:      
 
Domain Number 2 Region: 312-474
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-34
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 3 Region: 565-685
Classification Level Classification E-value
Superfamily SH2 domain 3.6e-26
Family SH2 domain 0.00064
Further Details:      
 
Domain Number 4 Region: 713-771
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-22
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 5 Region: 1-65
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000004
Family Calponin-homology domain, CH-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017657   Gene: ENSPTRG00000010378   Transcript: ENSPTRT00000019074
Sequence length 777
Comment pep:known chromosome:CHIMP2.1.4:19:6858457:6896503:1 gene:ENSPTRG00000010378 transcript:ENSPTRT00000019074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNRGIMP
FPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPK
MTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHT
HFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAAREDVQMKL
EECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLALDAMRDLAQ
CVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKMDRYAFLLD
KALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGYELFFKT
RELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHR
CRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPP
PPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSV
HLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYR
ITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAK
ARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
Download sequence
Identical sequences ENSPTRP00000017657 ENSPTRP00000017657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]