SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017670 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017670
Domain Number 1 Region: 988-1282
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.84e-81
Family Protein kinases, catalytic subunit 0.0000000000659
Further Details:      
 
Domain Number 2 Region: 333-498
Classification Level Classification E-value
Superfamily L domain-like 1.87e-52
Family L domain 0.0000000856
Further Details:      
 
Domain Number 3 Region: 33-194
Classification Level Classification E-value
Superfamily L domain-like 7.09e-44
Family L domain 0.0000001
Further Details:      
 
Domain Number 4 Region: 495-618
Classification Level Classification E-value
Superfamily Fibronectin type III 1.95e-33
Family Fibronectin type III 0.000000141
Further Details:      
 
Domain Number 5 Region: 794-936
Classification Level Classification E-value
Superfamily Fibronectin type III 3.99e-24
Family Fibronectin type III 0.00000222
Further Details:      
 
Domain Number 6 Region: 622-701,800-824
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-18
Family Fibronectin type III 0.0000324
Further Details:      
 
Domain Number 7 Region: 179-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000157
Family Growth factor receptor domain 0.0000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017670   Gene: ENSPTRG00000010386   Transcript: ENSPTRT00000019089
Sequence length 1374
Comment pep:known chromosome:CHIMP2.1.4:19:7158137:7347282:-1 gene:ENSPTRG00000010386 transcript:ENSPTRT00000019089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKWCVWCVCVVVCLWSVCEYEDSAGECCSCPKTDSQILKELEESSF
RKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSV
PTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEA
KADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALE
RGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLF
SVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRE
LGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVR
LLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMA
YLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESL
KDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDL
MRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVP
LDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
Download sequence
Identical sequences ENSPTRP00000017670 ENSPTRP00000017670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]