SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Pan troglodytes 69_2.1.4 > ENSPTRP00000017725

Domain assignment for ENSPTRP00000017725 from Pan troglodytes 69_2.1.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPTRP00000017725
Domain Number 1	Region: 123-165
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000576
Family	LDL receptor-like module	0.00075
Further Details:

Domain Number 2	Region: 53-88
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000903
Family	LDL receptor-like module	0.0011
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPTRP00000017725 Gene: ENSPTRG00000010417 Transcript: ENSPTRT00000019149
Sequence length	280
Comment	pep:novel chromosome:CHIMP2.1.4:19:8432745:8439303:-1 gene:ENSPTRG00000010417 transcript:ENSPTRT00000019149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	LSGGWMARVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQ CLTSGLCVPLTWRCYRDLDCEGSDEEECIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDK KLRNCSRLACPAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMG PPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASL VTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Download sequence
Identical sequences	9598.ENSPTRP00000017725 ENSPTRP00000017725 ENSPTRP00000017725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]