SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017915 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017915
Domain Number 1 Region: 343-457
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.75e-18
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000353
Family LDL receptor-like module 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000017915
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 127-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0868
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017915   Gene: ENSPTRG00000010505   Transcript: ENSPTRT00000019354
Sequence length 472
Comment pep:novel chromosome:CHIMP2.1.4:19:11664260:11677995:1 gene:ENSPTRG00000010505 transcript:ENSPTRT00000019354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGALPTDLPAPSAPD
LTEPKEEQPPVPSSPTEEEVVEEEEEEEEAEEEEEEEDSEEAPPPLSPPQPASPAEEDKM
PPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCY
ELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWVGPDHDKFSAMKYEQGTGCWQGPN
RSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Download sequence
Identical sequences 9598.ENSPTRP00000017915 ENSPTRP00000017915 ENSPTRP00000017915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]