SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018009 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018009
Domain Number 1 Region: 210-482
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.38e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000232
Further Details:      
 
Domain Number 2 Region: 9-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000455
Family Biotin repressor-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018009   Gene: ENSPTRG00000010550   Transcript: ENSPTRT00000019456
Sequence length 508
Comment pep:known chromosome:CHIMP2.1.4:19:13196014:13207592:-1 gene:ENSPTRG00000010550 transcript:ENSPTRT00000019456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPVAELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKR
WELTAEGEEIAREGSHEARVFRSIPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSA
FSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTH
SQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVF
SYHQGLKKWVEVGNSGVFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLDAEPRPPPTQEAA
Download sequence
Identical sequences G2HG47
ENSPTRP00000018009 ENSPTRP00000018009 NP_001233393.1.37143 9598.ENSPTRP00000018009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]