SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018549 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018549
Domain Number 1 Region: 34-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000665
Family I set domains 0.088
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000018549
Domain Number - Region: 142-179
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00249
Family TSP-1 type 1 repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018549   Gene: ENSPTRG00000010834   Transcript: ENSPTRT00000020059
Sequence length 369
Comment pep:known chromosome:CHIMP2.1.4:19:40422610:40426674:-1 gene:ENSPTRG00000010834 transcript:ENSPTRT00000020059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPMLRLLLHFAAPALGFYFSISCPSGKQCQQALLSGNDILLYCNSSGAHWYYLFTQGKK
GRLTSLTNISNMEIMPEGSLLIKDPLPSQMGLYHCWNKNGRQVVQYEIDFQDVTTLHITH
KDLGQRPLLNETLHLGSRQLIFTRWEPWQDCNRCEEPGERKRLGYCYIEEPLEEAMPCWL
YLGEVLVWSSRLRPELQVEACHVQCTNNTQPRVDWGIYDNFLFDRHTEFVWLDCTIRSMY
RPVNWRANDTPLTWESQLSGQDFITFLDPSTGGRQLQVFQPAVYKCFVQQELVAQFKPAA
SLETLEAQWRENDAQWREARKALRGRADSVLKGLKLVLLVVTVLALLGALLKFIHPSPGR
RSTQVLVVK
Download sequence
Identical sequences ENSPTRP00000018549 ENSPTRP00000018549 9598.ENSPTRP00000018549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]