SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018823 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018823
Domain Number 1 Region: 99-411
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-80
Family Protein kinases, catalytic subunit 0.0000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018823   Gene: ENSPTRG00000010981   Transcript: ENSPTRT00000020347
Sequence length 601
Comment pep:novel chromosome:CHIMP2.1.4:19:44989768:44996257:-1 gene:ENSPTRG00000010981 transcript:ENSPTRT00000020347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSA
STSPAPLDTCPSSSTASSISSSGGSSGSSSDNRTYRYSNRYCGGPGPPITDCEMNSPQVP
PSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSL
VGGPADCSPPHPAPAPQHPAASALRTRMTGGRPPLPPPDDPATLGPHLGLRGVPQSTAAS
S
Download sequence
Identical sequences A0A024R0M8 H2QGB5
ENSPTRP00000018823 ENSP00000221803 ENSP00000472941 ENSPTRP00000018823 ENSP00000221803 ENSP00000472941 NP_006475.1.87134 NP_006475.1.92137 XP_016791417.1.37143 XP_018871475.1.27298 gi|5922001|ref|NP_006475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]