SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018861 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018861
Domain Number 1 Region: 4-257,301-354
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-71
Family Protein kinases, catalytic subunit 0.0000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018861   Gene: ENSPTRG00000010995   Transcript: ENSPTRT00000020391
Sequence length 616
Comment pep:known chromosome:CHIMP2.1.4:19:45573906:45585746:-1 gene:ENSPTRG00000010995 transcript:ENSPTRT00000020391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTIQSETDCYDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRNSIIKNELKLLH
CMRGLDPEEAHVIRFLEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQV
LRALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRF
YRAPEILLGLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLH
AARKAHHFFKCNPHPDAANPWQLKSLADYLAETKVRPLERRKYMLKSLDQIETVNGGSVA
SRLTFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQQLRSAHETTH
YYQLSLRSYRLSLQVEGKPPTPVVAAEDGTPYYRLAEEKEAAGMGSVAGSSPFFREEKAP
GMQRSIDQLDDLSLQEAGHGLWGETCTDAVSDMMAPLKAAITGHHMPDSGPEPILAFYSS
RLAGRHKARKPPAGSKSDSNFSNLIRLSQVSPEDDRPCRGSSWEEGEHLGASAEPLAILQ
RDEDGPNIDNMTMEAQRPDPELFDPSSCPGEWLSEPDCTLESVRGPRAQGLPPRRSHQHG
PPRGATSFLQHVTGHH
Download sequence
Identical sequences H2QGC4
ENSPTRP00000018861 XP_009433835.1.37143 ENSPTRP00000018861 9598.ENSPTRP00000018861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]