SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018979 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018979
Domain Number 1 Region: 119-436
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-87
Family Protein kinases, catalytic subunit 0.0000000000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018979   Gene: ENSPTRG00000011049   Transcript: ENSPTRT00000020531
Sequence length 483
Comment pep:known chromosome:CHIMP2.1.4:19:47305779:47318459:-1 gene:ENSPTRG00000011049 transcript:ENSPTRT00000020531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYIKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTQSSQALTETPTSSDWQSTDATPTLT
NSS
Download sequence
Identical sequences K7C477
ENSPTRP00000018979 9598.ENSPTRP00000018979 ENSPTRP00000018979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]