SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019030 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019030
Domain Number 1 Region: 156-214
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000209
Family Snake venom toxins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019030   Gene: ENSPTRG00000011078   Transcript: ENSPTRT00000020599
Sequence length 267
Comment pep:known chromosome:CHIMP2.1.4:19:48558893:48580786:1 gene:ENSPTRG00000011078 transcript:ENSPTRT00000020599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARQIQTSSSQTSPEEAMGTPRIQHLLILLVLGTSLLTLGLELYCQKGLSMTVEADPAN
MFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIV
TSYSNYCEDYFYNDKDSLSQFWEFSETTASTVSTTLHCPTCVALGTCFSAPSLPCPNGTT
RCYQGKLEITGGGIESSVEVKGCTATIGCRLMSGILVVGPMFVREACPHQLLTQPRKTEN
GATCLPIPVWGLQLLLPLLLPSFIHFS
Download sequence
Identical sequences A0A2I3SHP3
ENSPTRP00000019030 9598.ENSPTRP00000019030 ENSPTRP00000019030 XP_003817640.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]