SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019416 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019416
Domain Number 1 Region: 4-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.07e-37
Family Interferon regulatory factor 0.000000961
Further Details:      
 
Domain Number 2 Region: 112-212
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.48e-33
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019416   Gene: ENSPTRG00000011309   Transcript: ENSPTRT00000021024
Sequence length 212
Comment pep:novel chromosome:CHIMP2.1.4:19:54661187:54665375:-1 gene:ENSPTRG00000011309 transcript:ENSPTRT00000021024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSDLITFTEG
SGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHI
SNSHPLSLTSDQYKAYLQDLVESMDFQGPGET
Download sequence
Identical sequences ENSPTRP00000019416 ENSPTRP00000019416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]