SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019651 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019651
Domain Number 1 Region: 170-487
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.45e-87
Family Protein kinases, catalytic subunit 0.0000000307
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-35
Family Synaptotagmin-like (S variant) 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019651   Gene: ENSPTRG00000011435   Transcript: ENSPTRT00000021291
Sequence length 521
Comment pep:known chromosome:CHIMP2.1.4:19:58809327:58824870:1 gene:ENSPTRG00000011435 transcript:ENSPTRT00000021291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDV
ERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNC
SLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMV
LGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHF
LTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGI
IYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSV
DWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGK
RLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTP
PDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
Download sequence
Identical sequences G7PYR2
ENSPTRP00000019651 ENSPTRP00000019651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]