SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019657 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019657
Domain Number 1 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-20
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019657   Gene: ENSPTRG00000011439   Transcript: ENSPTRT00000021297
Sequence length 236
Comment pep:known chromosome:CHIMP2.1.4:19:58952028:58975110:-1 gene:ENSPTRG00000011439 transcript:ENSPTRT00000021297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVL
RKVNDSGYKQEQSSAEKEAEFPFTDLKPKDAGRYFCAYKTAASHEWSESSEHLQLVVTDK
HDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHGSSSEESTKRTSHSKLPE
QEAAEADLSNMERVSLSTADPQGVTYAELSTSALSEAASDTTQEPPGSREYAALKV
Download sequence
Identical sequences H2QH33
ENSPTRP00000019657 XP_016792248.1.37143 XP_016802479.1.37143 9598.ENSPTRP00000019657 ENSPTRP00000019657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]