SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019871 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019871
Domain Number 1 Region: 28-302
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-91
Family Protein kinases, catalytic subunit 0.00000000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019871   Gene: ENSPTRG00000011547   Transcript: ENSPTRT00000021532
Sequence length 309
Comment pep:known chromosome:CHIMP2.1.4:19:62275056:62279549:1 gene:ENSPTRG00000011547 transcript:ENSPTRT00000021532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTIDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
Download sequence
Identical sequences H2QH96
ENSPTRP00000019871 9598.ENSPTRP00000019871 XP_003816716.1.60992 ENSPTRP00000019871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]