SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020106 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020106
Domain Number 1 Region: 53-149
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 2.09e-29
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00018
Further Details:      
 
Domain Number 2 Region: 133-246
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.43e-24
Family UBX domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020106   Gene: ENSPTRG00000011705   Transcript: ENSPTRT00000021798
Sequence length 259
Comment pep:known chromosome:CHIMP2.1.4:2A:24254539:24315204:1 gene:ENSPTRG00000011705 transcript:ENSPTRT00000021798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQ
VDVNIKLWKNGFTVNNDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKN
EICLSTKPVFQPFSGQGHRLGSATPKIVSKAKNIEIENKNNLSAVPLNNLEPITNIQIWL
ANGKRIVQKFNISHRVSHIKDFIEKYQGSQRSPPFSLATALPVLRLLDETLTLEEADLQN
AVIIQRLQKTASFRELSEH
Download sequence
Identical sequences H2QHI3
XP_001143201.1.37143 XP_009440377.1.37143 XP_009440378.1.37143 XP_016803506.1.37143 XP_016803515.1.37143 9598.ENSPTRP00000020106 ENSPTRP00000020106 ENSPTRP00000020106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]