SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020366 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020366
Domain Number 1 Region: 143-385
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000235
Family Protein kinases, catalytic subunit 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020366   Gene: ENSPTRG00000011862   Transcript: ENSPTRT00000022075
Sequence length 493
Comment pep:known chromosome:CHIMP2.1.4:2A:42722754:42733359:1 gene:ENSPTRG00000011862 transcript:ENSPTRT00000022075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRRAAVAAGFCASFLLGSVLNVLFAPGSEPPRPGQSPEPSPAPGPGRRGGRGELARQI
RARYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLPRPRPPWARPLPDGAPGWPPAPG
PGSPGPGPRLGCAALRNVSGAQYMGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVR
EFGVRRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVE
MIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDAR
VEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSL
RPLLDSIVNATGELTWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQE
DYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVV
PDPNKTTYVKASG
Download sequence
Identical sequences ENSPTRP00000020366 ENSPTRP00000020366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]