SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020411 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020411
Domain Number 1 Region: 404-716
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-92
Family Protein kinases, catalytic subunit 0.00000000953
Further Details:      
 
Domain Number 2 Region: 10-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.4e-26
Family PLC-like (P variant) 0.000000717
Further Details:      
 
Domain Number 3 Region: 235-294
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.73e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00039
Further Details:      
 
Domain Number 4 Region: 147-220
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.23e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020411   Gene: ENSPTRG00000011890   Transcript: ENSPTRT00000022122
Sequence length 736
Comment pep:known chromosome:CHIMP2.1.4:2A:46356512:46898544:1 gene:ENSPTRG00000011890 transcript:ENSPTRT00000022122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVFNGLLKKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTN
SPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEP
EGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPT
YCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNM
PHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAK
VLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELEN
NIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGK
VMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDR
LFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLD
AEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMM
AGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDA
IKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQIN
QEEFKGFSYFGEDLMP
Download sequence
Identical sequences ENSPTRP00000020411 9598.ENSPTRP00000020411 ENSPTRP00000020411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]