SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020517 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020517
Domain Number 1 Region: 23-317
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-52
Family Protein kinases, catalytic subunit 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020517   Gene: ENSPTRG00000011941   Transcript: ENSPTRT00000022235
Sequence length 508
Comment pep:known chromosome:CHIMP2.1.4:2A:58909612:59019580:1 gene:ENSPTRG00000011941 transcript:ENSPTRT00000022235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVV
KVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMV
MERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPD
QVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCM
LRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAY
DEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
EKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKI
SYTQFPSSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTRITDLESSTGLWPTISQFTLS
EETNADVYYYRIIIPVLLMLVFLALFFL
Download sequence
Identical sequences A0A2I3T725
ENSPTRP00000020517 XP_009440768.1.37143 XP_515492.3.37143 ENSPTRP00000020517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]