SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020811 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020811
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.38e-33
Family Gelsolin-like 0.00000141
Further Details:      
 
Domain Number 2 Region: 134-238
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.25e-28
Family Gelsolin-like 0.00000156
Further Details:      
 
Domain Number 3 Region: 244-347
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.89e-25
Family Gelsolin-like 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020811   Gene: ENSPTRG00000012132   Transcript: ENSPTRT00000022550
Sequence length 348
Comment pep:known chromosome:CHIMP2.1.4:2A:86581676:86598029:-1 gene:ENSPTRG00000012132 transcript:ENSPTRT00000022550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSH
LHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
VESAFHKTSTGAPAAIKKLYQVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGG
KSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLT
ADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQFFKDWK
Download sequence
Identical sequences H2QI91
XP_003816633.1.60992 XP_008967880.1.60992 XP_008967881.1.60992 XP_008967882.1.60992 XP_008967883.1.60992 XP_009441034.1.37143 XP_009441037.1.37143 XP_009441038.1.37143 XP_016804372.1.37143 XP_016804373.1.37143 XP_515584.1.37143 9598.ENSPTRP00000020811 ENSPTRP00000020811 ENSPTRP00000020811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]