SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020929 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020929
Domain Number 1 Region: 288-362
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.33e-18
Family Translational machinery components 0.014
Further Details:      
 
Domain Number 2 Region: 214-285
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000283
Family Ribosomal S5 protein, N-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020929   Gene: ENSPTRG00000012209   Transcript: ENSPTRT00000022677
Sequence length 429
Comment pep:known chromosome:CHIMP2.1.4:2A:95277944:95314489:-1 gene:ENSPTRG00000012209 transcript:ENSPTRT00000022677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPY
ASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKK
KKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWD
RKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKS
IRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKR
THIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQTHQQ
LADKKGLHVVEIREECGPLPIVVASPRGALRKDPEPEDEVPDVKLDWEDVKTAQGMKRSV
WSNLKRAAT
Download sequence
Identical sequences ENSPTRP00000020929 ENSPTRP00000020929 9598.ENSPTRP00000020929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]