SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021031 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021031
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.64e-66
Family LplA-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021031   Gene: ENSPTRG00000012273   Transcript: ENSPTRT00000022792
Sequence length 373
Comment pep:known chromosome:CHIMP2.1.4:2A:99371370:99377299:1 gene:ENSPTRG00000012273 transcript:ENSPTRT00000022792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPFSMKNCFQLLCNCQVPAAGFKKTVKNGLILQSVSNDVYQNLAVEDWIHDHMNLEGK
PILFFWRNSPSVVIGRHQNPWQECNLNLMRGEGIKLARRRSGGGTVYHDMGNINLTFFTT
KKKYDRMENLKLIVRALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTL
LCSTDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDPTLTCEVLMNAVATEYAAYHQ
IDNHIHLINPMDETLFPGINSKAKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFI
DIKNGRIEICNIEAPDHWLPLEIRDKLNSSLIGSKFCPTETTMLTNILLRTCPQDHKLNS
KWNILCEKIKGIM
Download sequence
Identical sequences H2QIE7
ENSPTRP00000021031 ENSPTRP00000021031 9598.ENSPTRP00000021031 XP_003309190.1.37143 XP_003309191.1.37143 XP_003309192.1.37143 XP_003949913.1.37143 XP_009441235.1.37143 XP_016804576.1.37143 XP_016804577.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]