SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021171 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021171
Domain Number 1 Region: 578-872
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-75
Family Protein kinases, catalytic subunit 0.000000716
Further Details:      
 
Domain Number 2 Region: 283-480
Classification Level Classification E-value
Superfamily Fibronectin type III 7.59e-26
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 93-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000134
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 4 Region: 187-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000326
Family I set domains 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021171   Gene: ENSPTRG00000012358   Transcript: ENSPTRT00000022949
Sequence length 999
Comment pep:known chromosome:CHIMP2.1.4:2A:112018912:112154173:1 gene:ENSPTRG00000012358 transcript:ENSPTRT00000022949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHATGYQ
PALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVP
NIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKIN
NEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNE
QPEKSPSVLTVPGLTEMAVFSCEAHNDKGLSVSKGVQINIKAIPSPPTEVSIRNSTAHSI
LISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSASPHLYQIKQLQALANYSIGVS
CMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFI
PAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLVLYISLAIRKRVQETKFGNAFTE
EDSELVVNYIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGS
VMEGNLKQEDGTSLKVAVKTMKLDNFSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMS
SQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFL
HRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSK
SDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMCSCWRTD
PLHRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPD
SIIASCTPRAAISVVTAEIHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGE
RLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM
Download sequence
Identical sequences A0A2J8JCR3
9598.ENSPTRP00000021171 XP_515690.3.37143 ENSPTRP00000021171 ENSPTRP00000021171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]