SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021243 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021243
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-39
Family Third domain of FERM 0.00061
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-35
Family Second domain of FERM 0.0000627
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-24
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021243   Gene: ENSPTRG00000012408   Transcript: ENSPTRT00000023033
Sequence length 733
Comment pep:known chromosome:CHIMP2.1.4:2B:120581253:120748428:1 gene:ENSPTRG00000012408 transcript:ENSPTRT00000023033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLDCPFDTAVQLAAYNLQAELGDYDLAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRSQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPS
ISSAPVPVEIENLPQSPGTDQHDRKCIPLNIELLNSPDLLETTIGDVIGASDTVETSQAL
NDVNVATRLSGLGEPEVEYETLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLT
DKCLNNVIESPGLNVMRVPPDFKSNILKAQVEAVHKVTKEDSLLSHKNASVQDAATNSAV
LNENNVPLPKESLETLMLITPADSGSVLKEATDELDALLASLTENLIDHTVAPQVSSTSM
ITPRWIVPQSGVMSNGLAGCEMLLTGKEGHGNKDGISLISPPAPFLVDAVTSSGPTLAEE
AVLKQKCLLTTEL
Download sequence
Identical sequences A0A2I3RAU7
ENSPTRP00000021243 9598.ENSPTRP00000021243 ENSPTRP00000021243 XP_016805095.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]