SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021316 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021316
Domain Number 1 Region: 82-261
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.32e-64
Family Brix domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021316   Gene: ENSPTRG00000012451   Transcript: ENSPTRT00000023113
Sequence length 291
Comment pep:known chromosome:CHIMP2.1.4:2B:131084354:131088567:1 gene:ENSPTRG00000012451 transcript:ENSPTRT00000023113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTEIRREALALQGSLEFD
DAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHE
VGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMS
EAKPHLITHGFSSRLGKRVSDILRYLFPVPKDDSHRVITFANQDDYISFRHHVYQKTDHR
NVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHSYTNSARKRVFLSAE
Download sequence
Identical sequences ENSPTRP00000021316 ENSPTRP00000021316 9598.ENSPTRP00000021316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]