SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021385 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021385
Domain Number 1 Region: 172-500
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.46e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000128
Further Details:      
 
Domain Number 2 Region: 26-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.9e-32
Family Anticodon-binding domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021385   Gene: ENSPTRG00000012500   Transcript: ENSPTRT00000023192
Sequence length 501
Comment pep:known chromosome:CHIMP2.1.4:2B:139865660:139948441:-1 gene:ENSPTRG00000012500 transcript:ENSPTRT00000023192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRDLVRVRDLTIQKADEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDIEGVV
RKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRL
DNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGV
EMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF
LGLHNVRQTSMFPRDPKRLTP
Download sequence
Identical sequences H2QIS1
ENSPTRP00000021385 ENSPTRP00000021385 9598.ENSPTRP00000021385 XP_001155169.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]