SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021397 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021397
Domain Number 1 Region: 1146-1411
Classification Level Classification E-value
Superfamily YWTD domain 1.11e-51
Family YWTD domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 1766-2011
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-47
Family YWTD domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 416-678
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-46
Family YWTD domain 0.00000529
Further Details:      
 
Domain Number 4 Region: 1461-1718
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-43
Family YWTD domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 91-336
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-42
Family YWTD domain 0.0000502
Further Details:      
 
Domain Number 6 Region: 2901-3156
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-41
Family YWTD domain 0.0000209
Further Details:      
 
Domain Number 7 Region: 2075-2342
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-32
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 8 Region: 3777-4055
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-30
Family YWTD domain 0.0000562
Further Details:      
 
Domain Number 9 Region: 2812-2893,3149-3210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1049-1138,1412-1456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000651
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 3643-3683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 763-808
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 13 Region: 728-764
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 14 Region: 3517-3553
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 15 Region: 806-846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 2776-2817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 3683-3801,4057-4103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000549
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 18 Region: 3478-3515
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 2645-2681
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 3238-3278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 851-889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3438-3473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 23 Region: 3559-3604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 24 Region: 3360-3396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 25 Region: 890-928
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00024
Further Details:      
 
Domain Number 26 Region: 2566-2602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 2431-2472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 28 Region: 2687-2723
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 938-974
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 30 Region: 3395-3435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 31 Region: 3321-3357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 3201-3236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 34-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 34 Region: 2475-2512
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 35 Region: 3280-3317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 36 Region: 1720-1770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.014
Further Details:      
 
Domain Number 37 Region: 2605-2647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 38 Region: 2396-2433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 39 Region: 2725-2765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 40 Region: 2525-2561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 41 Region: 984-1017
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 42 Region: 2030-2079
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 43 Region: 1020-1056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000117
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 44 Region: 684-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000439
Family EGF-type module 0.02
Further Details:      
 
Domain Number 45 Region: 4174-4209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000782
Family EGF-type module 0.027
Further Details:      
 
Domain Number 46 Region: 4274-4314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.04
Further Details:      
 
Domain Number 47 Region: 3605-3637
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000122
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 48 Region: 4138-4173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000648
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000021397
Domain Number - Region: 6-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000234
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4101-4137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000268
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 369-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000325
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 4211-4243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 2350-2411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0739
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021397   Gene: ENSPTRG00000012508   Transcript: ENSPTRT00000023205
Sequence length 4406
Comment pep:known chromosome:CHIMP2.1.4:2B:144263159:145286470:-1 gene:ENSPTRG00000012508 transcript:ENSPTRT00000023205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHG
SYTCSCVEGYLMQPDNRSCKAKIEPTDRPPILLIANFETIEVFYLNGSKMATLSSVNGNE
IHTLDFIYNEDMICWIESRESSNQLKCIQITKAGGLTDEWTINILQSFHNVQQMAIDWLT
RNLYFVDHVSDRIFVCNSNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERC
DMDGMNRTRIIDSKTEQPAALALDLVNKLVYWVDLYLDYVGVVDYQGKNRHTVIQGRQVR
HLYGITVFEDYLYATNSDNYNIVRINRFNGTDIHSLIKIENARGIRIYQKRTQPTVRSHA
CEVDPYGMPGGCSHICLLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGI
VRGMDLNTKIADEYMIPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETIL
KDDLDNVEGIAVDWIGNNLYWTNDGHTKTINVARLEKASQSRKTLLEGEMSHPRGIVVDP
VNGWMYWTDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDA
YYDHIEKVFLNGTHRKIVYSGRELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITSEVTLL
RHERPPLFGLQIYDPRKQQGDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDENGTTCT
FNPGEALPHICKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCQ
NNRCIPKRWLCDGANDCGSNEDESNQTCTARTCQVDQFSCGNGRCIPRAWLCDREDDCGD
QTDEMASCEFPTCEPLTQFVCKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCFDNQFRCS
SGRCIPGHWACDGDNDCGDFSDEAQINCTKEEIRSPAGCNGNEFQCHPDGNCVPDLWRCD
GEKDCEDGSDEKGCNGTTRLCDHKTKFSCWSTGRCINKAWVCDGDIDCEDQSDEDDCDSF
LCGPPKHPCANDTSVCLQPEKLCNGKKDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGRG
IVCSCPEGLQLNKDNKTCEIVDYCSNHLKCSQVCEQHKHTVKCSCYEGWKLDVDGESCTS
VDPFEAFIIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYR
GKLSESGGVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIA
GAMEHPRAIALDPRYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDH
FEKRIVWTDARSDAIYSALYDGTNMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSK
ANKWTGQNVSVIQKTSAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLINHNRSAAC
ACPHLMKLSSDKKTCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFD
ASEERLYWTDIKTQTIKRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQ
INVARLDGSLKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKE
PVGLSIDYVENKLYWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWAD
QNLAQLGTCSKRDGRNPTILRNKTSGVVHMKVYDKEAQQGSNSCQLNNGGCSQLCLPTSE
TTRTCMCTVGYYLQKNRMSCQGIESFLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVG
IDFHAENDTIYWTDMGFNKISRAKRDQTWKEDIITNGLGRVEGIAVDWIAGNIYWTDHGF
NLIEVARLNGSFRYVIISQGLDQPRSIAVHPEKGLLFWTEWGQMPCIGKARLDGSEKVVL
VSMGIAWPNGISIDYEENKLYWCDARTDKIERIDLETGGNREMVLSGSNVDMFSVAVFGA
YIYWSDRAHANGSVRRGHKNDATETITMRTGLGVNLKEVKIFNRVREKGTNVCARDNGGC
KQLCLYRGNSRRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRP
YENPHYFKNVIALAFDYNQRRKGTNRIFYSDAHFGNIQLIKDNWEDRQVIVENVGSVEGL
AYHRAWDTLYWTSSTTSSITRHTVDQTRPGAFDREAVITMSEDDHPHVLALDECQNLMFW
TNWNEQHPSIMRSTLTGKNAQVVVSTDILTPNGLTIDYRAEKLYFSDGSLGKIERCEYDG
SQRHVIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGII
AVANDTNSCELSPCALLNGGCHDLCLLTPNGRVNCSCRGDRILLEDNRCVTKNSSCNVYS
EFECGNGECIDYQLTCDGIPHCKDKSDEKLLYCENRSCRRGFKPCYNRRCIPHGKLCDGE
NDCGDNSDELDCKVSTCATVEFRCADGTCIPRSARCNQNIDCADASDEKNCNNTDCTHFY
KLGVKTTGFIRCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYFSCPSGRC
ILNTWICDGQKDCEDGRDEFHCDSSCSWNQFACSAQKCISKHWICDGEDDCGDGLDESDS
ICGAITCAADMFSCQGSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENAFMCHN
KVCIPKQFVCDHDDDCGDGSDESPQCGYRQCGTEEFSCADGRCLLNTQWQCDGDFDCPDH
SDEAPLNPKCKSAEQSCNSSFFMCKNGRCIPSGGLCDNKDDCGDGSDERNCHINECLSKK
VSGCSQDCQDLPVSYKCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCINTYGTYKCLCT
DGYEIQPDNPNGCKSLSGEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYRE
EFIYWIDSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVS
KLNGLYPTILVSKRLKFPRDLSLDPRAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKIS
RPMALTIDYVNRRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKT
KSLSRAHKTSGADRISLIYSWHAITDIQVYHSYRQPDVSKHLCMINNGGCSHLCLLAPGK
THTCACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPE
FKCQPGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNL
RCNGQDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDKDPDCADASDEANCDKK
TCGPHEFQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWC
DGDFDCADGSDERNCETSCSKDQFRCSSGQCIPAKWKCDGHEDCKYGEDEKSCEPASPTC
SSSEYICASGGCISASLKCNGEYDCADGSDEMDCVTECKEDQFRCKNKAHCIPIRWLCDG
IHDCVDGSDEENCDRGGNICRADEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCVKFL
CPSTRPHRCRNNRICLQSEQMCNGIDDCGDNSDEDHCGGKLTYKARPCKKDEFACSNKKC
IPMDLQCDRLDDCGDGSDEQGCRIAPTEYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQ
RNMKNRQCEDLNECLVFGTCSHQCINVEGSYKCVCDQNFQERNNTCIAEGSEDQVLYIAN
DTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHDR
EKRQANSGLICPEFKRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLN
GPNCTRLLTNMAGEPYAIAVNPKRGMMYWTVVGDHSHIEEAARDGTLRRILVQKNLQRPT
GLAVDYFSERIYWADFELSIIGSVLYDGSNSVVSVSSKQGLLHPHRIDIFEDYIYGAGPK
NGVFRVQKFGHGSVEYLALNIDKTKGVLIAHRYKQLDLPNPCLDLACEFLCLLNPSGATC
VCPEGKYLINGTCNDDSLLDDSCKLTCENGGRCILNEKGDLRCHCWPSYSGERCEVNHCS
NYCQNGGTCVPSVLGRPTCSCALGFTGPNCGKTVCEEFCQNGGTCIVTAGNQPYCHCQPE
YTGDRCQYYVCYHYCVNSESCTIGDDGSVECVCPTRYEGPKCEVDKCVRCHGGHCIINKD
SEDIFCNCTNGKIASSCQLCDGYCYNGGTCQLDPETNVPVCLCSTNWSGTQCERPAPRSS
KSDHISTRSIAIIVPLVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPS
YNMYEVDHDHNDGGLLDPGFMIDPTK
Download sequence
Identical sequences ENSPTRP00000021397 ENSPTRP00000021397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]