SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021405 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021405
Domain Number 1 Region: 180-475
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-61
Family Protein kinases, catalytic subunit 0.000000845
Further Details:      
 
Domain Number 2 Region: 26-120
Classification Level Classification E-value
Superfamily Snake toxin-like 7.99e-36
Family Extracellular domain of cell surface receptors 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021405   Gene: ENSPTRG00000012514   Transcript: ENSPTRT00000023213
Sequence length 512
Comment pep:known chromosome:CHIMP2.1.4:2B:151919172:152007524:1 gene:ENSPTRG00000012514 transcript:ENSPTRT00000023213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAKLGFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGVLWELASRCTAADGPVDEYMLPFEEEIGQ
HPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQ
MQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
Download sequence
Identical sequences ENSPTRP00000021405 ENSPTRP00000021405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]