SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021415 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021415
Domain Number 1 Region: 81-166
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000646
Family Snake venom toxins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021415   Gene: ENSPTRG00000012523   Transcript: ENSPTRT00000023223
Sequence length 207
Comment pep:known chromosome:CHIMP2.1.4:2B:153223521:153403951:1 gene:ENSPTRG00000012523 transcript:ENSPTRT00000023223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIIIFSESW
AFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGDNYNCNRWAEDKWCPQNTQYCLTVHHF
TSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMICNVELPTNHTNAVFAVM
HAQRTSGSSAPTLYLPVLAWVFVLPLL
Download sequence
Identical sequences H2QIT4
XP_009441726.1.37143 XP_016805292.1.37143 XP_525939.3.37143 ENSPTRP00000021415 ENSPTRP00000021415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]