SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021417 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021417
Domain Number 1 Region: 45-129
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000022
Family Snake venom toxins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021417   Gene: ENSPTRG00000012524   Transcript: ENSPTRT00000023225
Sequence length 171
Comment pep:known chromosome:CHIMP2.1.4:2B:153528882:153673840:1 gene:ENSPTRG00000012524 transcript:ENSPTRT00000023225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYE
CNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTS
CCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML
Download sequence
Identical sequences A0A0D9RUD0 G3QWS4 H2P7I6 H2QIT5 Q86Y78
NYSGRC-34996523 ENSPTRP00000021417 ENSGGOP00000007242 ENSPPYP00000014331 ENSGGOP00000007242 gi|307574638|ref|NP_001182614.1| gi|34996523|ref|NP_919298.1| NP_001182614.1.87134 NP_001182614.1.92137 NP_919298.1.87134 NP_919298.1.92137 XP_003816731.1.60992 XP_004032685.1.27298 XP_004032686.1.27298 XP_007963140.1.81039 XP_009235974.1.23681 XP_016805297.1.37143 9598.ENSPTRP00000021417 9600.ENSPPYP00000014331 9606.ENSP00000334463 ENSPPYP00000014331 ENSP00000334463 ENSPTRP00000021417 ENSP00000334463 ENSP00000386413 ENSP00000334463 ENSP00000386413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]