SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021455 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021455
Domain Number 1 Region: 174-481
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-66
Family Protein kinases, catalytic subunit 0.000000000135
Further Details:      
 
Domain Number 2 Region: 24-100
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000143
Family Extracellular domain of cell surface receptors 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021455   Gene: ENSPTRG00000012554   Transcript: ENSPTRT00000023265
Sequence length 493
Comment pep:known chromosome:CHIMP2.1.4:2B:161762912:161858711:-1 gene:ENSPTRG00000012554 transcript:ENSPTRT00000023265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRALCSALRQALLLLAAAAELSAGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITV
PVCLLSIAAMLTVWACQGRQCSYRKKKRPNVEEPLSECNLVNAGKTLKDLIYDVTASGSG
SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ
TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIA
SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQN
PKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD
MVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKK
TISQLCVKEDCKA
Download sequence
Identical sequences H2QIU8
XP_525945.2.37143 ENSPTRP00000021455 ENSPTRP00000021455 9598.ENSPTRP00000021455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]