SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021504 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021504
Domain Number 1 Region: 426-537
Classification Level Classification E-value
Superfamily SH2 domain 1.13e-32
Family SH2 domain 0.00000496
Further Details:      
 
Domain Number 2 Region: 102-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-30
Family Ras-binding domain, RBD 0.00034
Further Details:      
 
Domain Number 3 Region: 229-343
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000145
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021504   Gene: ENSPTRG00000012587   Transcript: ENSPTRT00000023319
Sequence length 540
Comment pep:known chromosome:CHIMP2.1.4:2B:168800278:168928846:-1 gene:ENSPTRG00000012587 transcript:ENSPTRT00000023319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSLQDGQSASSRAAARNSPLAAQVCGATHARGDAHDLAPAPWLHARALLPLPDGTRGC
AAYRRKKKDLDVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSR
ALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIE
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGA
PTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGC
SSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMS
HGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL
Download sequence
Identical sequences ENSPTRP00000021504 9598.ENSPTRP00000021504 ENSPTRP00000021504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]