SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021817 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021817
Domain Number 1 Region: 28-320
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-75
Family Protein kinases, catalytic subunit 0.000000666
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021817   Gene: ENSPTRG00000012763   Transcript: ENSPTRT00000023651
Sequence length 372
Comment pep:known chromosome:CHIMP2.1.4:2B:200802451:200840712:-1 gene:ENSPTRG00000012763 transcript:ENSPTRT00000023651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYA
AKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFN
LCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDF
GMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDN
QETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFEN
LFHPEETSSSSQTQDHSIRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSL
PNPHELVSDLLC
Download sequence
Identical sequences G3RKZ0 H2QJ65
ENSPTRP00000021817 ENSGGOP00000016422 ENSGGOP00000016422 XP_001168212.1.37143 XP_003825345.1.60992 XP_004033033.1.27298 XP_016805743.1.37143 XP_018878364.1.27298 ENSPTRP00000021817 9598.ENSPTRP00000021817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]