SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022133 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022133
Domain Number 1 Region: 1557-1798
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-34
Family Protein kinases, catalytic subunit 0.0000414
Further Details:      
 
Domain Number 2 Region: 2869-3113
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.64e-34
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 3 Region: 1062-1156
Classification Level Classification E-value
Superfamily Immunoglobulin 4.56e-23
Family I set domains 0.00081
Further Details:      
 
Domain Number 4 Region: 1281-1384,2575-2671
Classification Level Classification E-value
Superfamily Fibronectin type III 5.53e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 867-960
Classification Level Classification E-value
Superfamily Immunoglobulin 6.9e-22
Family I set domains 0.0062
Further Details:      
 
Domain Number 6 Region: 719-812
Classification Level Classification E-value
Superfamily Immunoglobulin 7.16e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 2488-2580
Classification Level Classification E-value
Superfamily Immunoglobulin 9.59e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 8 Region: 1188-1280
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 9 Region: 40-126
Classification Level Classification E-value
Superfamily Immunoglobulin 1.63e-18
Family I set domains 0.0056
Further Details:      
 
Domain Number 10 Region: 971-1059
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000439
Family I set domains 0.0072
Further Details:      
 
Domain Number 11 Region: 1388-1480
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000275
Family I set domains 0.065
Further Details:      
 
Domain Number 12 Region: 1485-1541
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000329
Family I set domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022133   Gene: ENSPTRG00000012957   Transcript: ENSPTRT00000024003
Sequence length 3148
Comment pep:known chromosome:CHIMP2.1.4:2B:224517582:224576949:1 gene:ENSPTRG00000012957 transcript:ENSPTRT00000024003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGGPVAVAGAPVFLRPLKNAAVCAGSDV
RLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNERGRASCE
AVLTVLEVGDSETAEDDISDVQGTQRLELRDDGAFSTPTGGSDTLVGTSLDTPPTSVTGT
SEEQVSWWGSGQTVLEQEAGSGGGTRRLPGSPRQAQATGAGPRHLGVEPLVRASRANLVG
ASWGSEDSLSVASDLYGSAFSLYRGRALSIHVSVPQSGLRREEPDLQPQLASEAPRRPAQ
PPPSKSALLPPPSPRVGKRSPPGPPAQPAATPTSPHRRTQEPVLPEDTTTEEKRGKKSKS
SGPSLAGTAESRPQTPLSEASGRLSALGRSPRLVRAGSRILDKLQFFEERRRSLERSDSP
PAPLRPWVPLRKARSLEQPKSERGAPWGTPGASQEELRAPGSVAERRRLFQQKAASLDER
TRQRSPASDLELRFAQELGRIRRSTSREELVRSHESLRATLQRAPSPREPGEPPLFSRPS
TPKTSRAVSPAAAQPPSPSSAEKPGDEPGRPRSRGPAGRTEPGEGPQQEVRRRDQFPLTR
SRAIQECRSPVPPPAADPPEARTKASPGRKREPPAQAVRFLPWATPGLEGAAVPQTLEKN
RAGPEAEKRLRRGPEEDGPWGPWDRRGARSQGKGRRARPTSPELESSDDSYVSAGEEPLE
APVFEIPLQNVVVAPGADVLLKCIVTANPLPQVSWHKDGSALRSEGRLLLRAEGERHTLL
LREARAADAGSYMATATNELGQATCAASLTVRPGGSTSPFSSPITSDEEYLSPPEEFPEP
GETWPRTPTMKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVV
SWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVR
AHPESRSLAVLAPLQDVDVGAGEMALFECLVAGPTDVEVDWLCRGRLLQPALLKCKMHFD
GRKCKLLLTSVHEDDSGVYTCKLSTAKDELTCSARLTVRPSLAPLFTRLLEDVEVLEGRA
ARFDCKISGTPPPVVTWTHFGRPMEESENLRLRQDGGLHSLHIAHVGSEDEGLYAVSAVN
THGQAHCSAQLYVEEPRTAASGPSSKLEKMPSIPEEPEQGELERLSIPDFLRPLQDLEVG
LAKEAMLECQVTGLPYPTISWFHNGHRIQSSDDRRMTQYRDVHRLVFPAVGPQHAGVYKS
VIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTY
TVQHQVLGSDQWTALVTGLREPGWAATGLRKGVQHIFRVLSTTVKSSSKPSPPSEPVQLL
EHGPPLEEAPAMLDKPDIVYVVEGQPASITVTFNHVEAQVVWRSCRGALLEARAGVYELS
QPDDDQYCLRICQVSRRDMGALTCTARNRHGTQTCSVTLELAGGDEVLLTESSHVSFVYE
ENECSLVVLSTGAQDGGVYTCTAQNLAGEVSCKAELAVHSAQTAMEVEGVGEDEDHRGRR
LSDFYDIHQEIGRGAFSYLRRVVERSSGLEFAAKFIPSQAKPKASARREARLLARLQHDC
VLYFHEAFERRRGLVIVTELCTEELLERMARKPTVCESEIRAYMRQVLEGIHYLHQSHVL
HLDVKVRWGLESRQPLLTGISPFVGENDRTTLMNIRNYNVAFEETTFLSLSREARGFLIK
VLVQDQLRPTAEETLEHPWFKTQAKGAEVSTDHLKLFLSRRRWQRSQISYKCHLVLRPIP
ELLRAPPERVWVTMPRRPPPSGGLSSSSDSEEEELEELPSVPRPLQPEFSGSRVSLTDIP
TEDEALGTPETGAATPMDWQEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRGGELRRGS
SAESALPRAGPRELGRGLHKAASVELPQRRSPSPGATRLARGGLGEGEYAQRLQALRQRL
LRGGPEDGKVSGLRGPLLESLGGRARDPRMARAASSEAAPHHQPPLENRGLQKSSSFSQG
EAEPRGRHRRAGAPLEIPVARLGARRLQESPSLSALSEAQPSSPARPSAPKPSTPKSAEP
SATIPSDAPQPPAPQPAQDKAPEPRPEPVRASKPVPPPQALQTLALPLTPYAQIIQSLQL
SGHAQGPPQGPAASPSEPKPHAAVFARVASPPPGAPEKRVPSAGGPPVLAEKARVPTVPP
RPGSSLSSSIENLESEAVFEAKFKRSRESPLSLGLRLLSRSRSEERGPFRGAEEEDGIYR
PSPAGTPLELVRRPERSRSVQDLRAVGEPGLVRRLSLSLSQRLRRTPPAQRHPAWEARGG
DGESSEGGSSARGSPVLAMRRRLSSTLERLSSRLQRSGSSEDSGGASGRSTPLFGRLRRA
TSEGESLRRLGLPHNQLAAQAGATTPSAESLGSEASATSGSSAPGESRSRLRWGFSRPRK
DKGLLPPNLSASVQEELGHQYVRSESDFPPVFHIKLKDQVLLEGEAATLLCLPAACPAPH
ISWMKDKKSLRSEPSVIIVSCKDGRQLLSIPRAGKRHAGLYECSATNVLGSITSSCTVAV
ARVPGKLAPPEVPQTYQDTALVLWKPGDSRAPCTYTLERRVDGESVWHPVSSGIPDCYYN
VTHLPVGVTVRFRVACANRAGQGPFSNPSEKVFVRGTQDSSAVPSAAHQEAPVTSGPARA
PPPDSPTSLAPPLAPAAPTPPSVTVSPSSPPTPPSQALSSLKAVGPPPQTPPRRHRGLQA
ARPAEPALPSTHITPSEPKPFVLDTGTPIPASTPQGVKPVSSSTPVYVVTSFVSAPPAPE
PPAPEPPPEPTKVTVQSLSLAKEVVSSPGSSPRSSPRPEGTTLRQGPPQKPYTFLEEKAR
GRFGVVRACRENATGRTFVAKIVPYAAEGKRRVLQEYEVLRTLHHERIMSLHEAYITPRY
LVLIAESCGNRELLCGLSDSQTTCCWPLTMPSRSWTSAVPSPTTPRPLGPLATARARWSS
WVRGPAASQAPEMVKGEPIGSATDIWGAGVLTYIMLSGRSPFYEPDPQETETRIVGGRFD
AFQLYPNTSQSATLFLRKVLSVHPWSRPSLQDCLAHPWLQDAYLMKLRRQTLTFTTNRLK
EFLGEQRRRRAEAATRHKVLLRSYPGGP
Download sequence
Identical sequences ENSPTRP00000022133 ENSPTRP00000022133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]