SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022171 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022171
Domain Number 1 Region: 371-587
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.14e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 305-378
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000137
Family Domains B1 and B5 of PheRS-beta, PheT 0.016
Further Details:      
 
Domain Number 3 Region: 5-85
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000324
Family Domains B1 and B5 of PheRS-beta, PheT 0.0091
Further Details:      
 
Domain Number 4 Region: 219-281
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000246
Family B3/B4 domain of PheRS, PheT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022171   Gene: ENSPTRG00000012974   Transcript: ENSPTRT00000024042
Sequence length 589
Comment pep:known chromosome:CHIMP2.1.4:2B:227670167:227756872:-1 gene:ENSPTRG00000012974 transcript:ENSPTRT00000024042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDV
VLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPF
AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSD
IKFKPLNKTKEYTACELMNIYKTDSHLKHYLHIIENKPLYPVIYDSNGVVLSMPPIINGD
HSKITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFP
ELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIH
ACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQ
EDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDI
VIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEG
PAFFPGRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL
Download sequence
Identical sequences G2HDY3
9598.ENSPTRP00000022171 ENSPTRP00000022171 NP_001233467.1.37143 XP_003818721.1.60992 ENSPTRP00000022171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]