SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022472 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022472
Domain Number 1 Region: 535-746
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-52
Family DBL homology domain (DH-domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 227-372
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-41
Family Third domain of FERM 0.0005
Further Details:      
 
Domain Number 3 Region: 731-856
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-30
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 4 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.11e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 5 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-21
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022472   Gene: ENSPTRG00000013123   Transcript: ENSPTRT00000024358
Sequence length 890
Comment pep:known chromosome:CHIMP2.1.4:2B:246692740:246826786:1 gene:ENSPTRG00000013123 transcript:ENSPTRT00000024358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTAGTRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGLEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKANAYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEVYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHMSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
EFKDSSSSRTDPQVSYIKSPAAERSSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDYEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPVTLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYTPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGVENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
MLLYTSKGVAGTSHFRIRGLLPLRGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
EKWMLDLNSAIQAAKSGGDTAPALPGGTACTRPPRSPNEVSLEQESEDDA
Download sequence
Identical sequences ENSPTRP00000022472 ENSPTRP00000022472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]